HPA028521

CFAP74 antibody from Atlas Antibodies
C1orf222, FLJ45476, KIAA1751
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA028521
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA028521, RRID:AB_10601881
Product name
Anti-CFAP74
Provider product page
Atlas Antibodies - HPA028521
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
HLRDFIHVDFDPPGPLSAGMSCEVLVTFKPMINKD
LEGNISFLAQTGEFSVPLKCSTKKCSLSLDKELID
FGSYVVGETTSRTITLTN
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -