PAB22266

CFAP74 antibody from Abnova Corporation
C1orf222, FLJ45476, KIAA1751

Antibody data

Product number
PAB22266
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB22266, RRID:AB_10968440
Product name
KIAA1751 polyclonal antibody
Provider product page
Abnova Corporation - PAB22266
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant KIAA1751.
Antigen sequence
LDVPVESLTAIPVFDPRHREASSRPGPLSPEAEEL
RPILVTLDYIQFDTDTPAPPATRELQVGCIRTTQP
SPKK
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -