PAB22423

CFAP74 antibody from Abnova Corporation
C1orf222, FLJ45476, KIAA1751

Antibody data

Product number
PAB22423
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB22423, RRID:AB_10966256
Product name
KIAA1751 polyclonal antibody
Provider product page
Abnova Corporation - PAB22423
Antibody type
Polyclonal
Antigen
Recombinant protein corresponding to amino acids of human KIAA1751.
Reactivity
Human
Host
Rabbit
Antigen sequence
QELEAQKRAFEEEQKLRKQEIISRILKEEAEEEKR
KKQHPPTSARHRLTLRDKTWNYISDFCKKTTVPTN
TYTLDYEAAAGPGPSRLLEVVSSELIQ
Isotype
IgG
Vial size
100 µL
Storage
Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -