HPA028521

CFAP74 antibody from MilliporeSigma / Merck KGaA
C1orf222, FLJ45476, KIAA1751
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028521
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA028521, RRID:AB_10601881
Product name
Anti-C1orf222 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA028521
Antibody type
Polyclonal
Antigen
KIAA1751 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HLRDFIHVDFDPPGPLSAGMSCEVLVTFKPMINKD
LEGNISFLAQTGEFSVPLKCSTKKCSLSLDKELID
FGSYVVGETTSRTITLTN
Storage
-20C
Provider Type Product Number
- No reagents -