Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00084901-D01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00084901-D01, RRID:AB_10719569
- Product name
- NFATC2IP MaxPab rabbit polyclonal antibody (D01)
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against a full-length human NFATC2IP protein.
- Antigen sequence
MSEPLQSVVDHMATHLGVSPSRILLLFGETELSPT
ATPRTLKLGVADIIDCVVLTSSPEATETSQQLQLR
VQGKEKHQTLEVSLSRDSPLKTLMSHYEEAMGLSG
RKLSFFFDGTKLSGRELPADLGMESGDLIEVWG- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of NFATC2IP expression in transfected 293T cell line (H00084901-T02) by NFATC2IP MaxPab polyclonal antibody.Lane 1: NFATC2IP transfected lysate(15.1 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of purified MaxPab antibody to NFATC2IP on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of NFATC2IP transfected lysate using anti-NFATC2IP MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with NFATC2IP purified MaxPab mouse polyclonal antibody (B01P) (H00084901-B01P).
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol