Antibody data

Product number
H00009220-M04
Provider
Abnova Corporation
Product name
TIAF1 monoclonal antibody (M04), clone 3B9
Provider product page
Abnova Corporation - H00009220-M04
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant TIAF1.
Antigen sequence
MSSPSSPFREQSFLCAAGDAGEESRVQVLKNEVRR
GSPVLLGWVEQAYADKCVCGPSAPPAPTPPSLSQR
VMCNDLFKVNPFQLQQFRADPSTASLLLCPGGLDH
KLNLRGKAWG
Isotype
IgG
Antibody clone number
3B9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -