Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501395 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Calcium Channel, Voltage Dependent, T Type, alpha 1I Subunit (CACNA1I) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CACNA1I antibody: synthetic peptide directed towards the middle region of human CACNA1I
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Canine, Zebrafish
- Host
- Rabbit
- Antigen sequence
LRTDTGDTVPDRKNFDSLLWAIVTVFQILTQEDWN
VVLYN GMASTSPWAS- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Selective inhibition of Cav3.3 T-type calcium channels by Galphaq/11-coupled muscarinic acetylcholine receptors.
Hildebrand ME, David LS, Hamid J, Mulatz K, Garcia E, Zamponi GW, Snutch TP
The Journal of biological chemistry 2007 Jul 20;282(29):21043-55
The Journal of biological chemistry 2007 Jul 20;282(29):21043-55
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Western Blotting