HPA027549

TC2N antibody from MilliporeSigma / Merck KGaA
C14orf47, C2CD1, FLJ36557, MTAC2D1, Tac2-N
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027549
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA027549, RRID:AB_10603346
Product name
Anti-TC2N antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA027549
Antibody type
Polyclonal
Antigen
tandem C2 domains, nuclear recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IKSCCGGCFYGETEKHNFSVERDFKAAVPNSQNAT
ISVPPLTSVSVKPQLGCTEDYLLSKLPSDGKEVPF
VVPKFKLSYIQPRTQETPSHLEELEGSARASFGDR
KVELSSSSQHGPSYDVYNPFYMYQHISPDLSRRF
Storage
-20C
Provider Type Product Number
- No reagents -