HPA015919

WSCD1 antibody from Sigma-Aldrich
KIAA0523
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015919
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015919, RRID:AB_2216211
Product name
Anti-WSCD1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015919
Antibody type
Polyclonal
Antigen
WSC domain-containing protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NITHAFPSSLIQANVTVGTCSGFCSQKEFPLAILR
GWECYCAYPTPRFNLRDAMDSSVCGQDPEAQRLAE
YCEVYQTPVQDTRCTDRRFLPNKSKVFVALSSFPG
AG
Storage
-20C
Provider Type Product Number
- No reagents -