H00002107-M02

ETF1 antibody from Abnova Corporation
ERF, ERF1, RF1, SUP45L1, TB3-1

Antibody data

Product number
H00002107-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00002107-M02, RRID:AB_1137193
Product name
ETF1 monoclonal antibody (M02), clone 2H4
Provider product page
Abnova Corporation - H00002107-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant ETF1.
Antigen sequence
TEEEKILYLTPEQEKDKSHFTDKETGQEHELIESM
PLLEWFANNYKKFGATLEIVTDKSQEGSQFVKGFG
GIGGILRYRVDFQGMEYQGGDDEFFDLDDY
Isotype
IgG
Antibody clone number
2H4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -