Antibody data

Product number
H00003119-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00003119-M01, RRID:AB_1577822
Product name
HLA-DQB1 monoclonal antibody (M01), clone 4B7-E2
Provider product page
Abnova Corporation - H00003119-M01
Antibody type
Monoclonal
Antigen
HLA-DQB1 (AAH12106, 1 a.a. ~ 265 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. (A deletion mutation of cytidine at 783bp happened to the immunogen of this antibody, resulting in 4 additional aa (ERPH) translated at
Reactivity
Human
Host
Mouse
Antigen sequence
MSWKKALRIPGGLRVATVTLMLAMLSTPVAEGRDS
PEDFVYQFKGMCYFTNGTERVRLVTRYIYNREEYA
RFDSDVGVYRAVTPLGPPAAEYWNSQKEVLERTRA
ELDTVCRHNYQLELRTTLQRRVEPTVTISPSRTEA
LNHHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVV
STPLIRNGDWTFQILVMLEMTPQRGDVYTCHVEHP
SLQNPIIVEWRAQSESAQSKMLSGIGGFVLGLIFL
GLGLIIHHRS
Isotype
IgG
Vial size
100 µg
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -