HPA013667

HLA-DQB1 antibody from Sigma-Aldrich
CELIAC1, HLA-DQB, IDDM1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013667
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013667, RRID:AB_1853932
Product name
Anti-HLA-DQB1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013667
Antibody type
Polyclonal
Antigen
HLA class II histocompatibility antigen, DQB1*0602 beta chain precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RPDAEYWNSQKEVLEGTRAELDTVCRHNYEVAFRG
ILQRRVEPTVTISPSRTEALNHHNLLVCSVT
Storage
-20C
Provider Type Product Number
- No reagents -