Antibody data

Product number
H00051268-M10
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00051268-M10, RRID:AB_1137372
Product name
PIPOX monoclonal antibody (M10), clone 3D1
Provider product page
Abnova Corporation - H00051268-M10
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant PIPOX.
Antigen sequence
IGDVQILSSFVRDHLPDLKPEPAVIESCMYTNTPD
EQFILDRHPKYDNIVIGAGFSGHGFKLAPVVGKIL
YELSMKLTPSYDLAPFRISRFPG
Isotype
IgG
Antibody clone number
3D1
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.