HPA015567

PIPOX antibody from Sigma-Aldrich
LPIPOX
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015567
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015567, RRID:AB_1855400
Product name
Anti-PIPOX antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015567
Antibody type
Polyclonal
Antigen
Peroxisomal sarcosine oxidase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MVPGSYGVSQAFPCFLWLGLCPHHIYGLPTGEYPG
LMKVSYHHGNHADPEERDCPTARTDIGDVQILSSF
VRDHLPDLKPEPAVIESCMYTNTPDEQFILDRHPK
YDNIVIGAGFSGHGFKLAPV
Storage
-20C
Provider Type Product Number
- No reagents -