HPA015568

LRRC3B antibody from Sigma-Aldrich
LRP15
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015568
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015568, RRID:AB_1853282
Product name
Anti-LRRC3B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015568
Antibody type
Polyclonal
Antigen
Leucine-rich repeat-containing protein 3B precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CPKGCLCSSSGGLNVTCSNANLKEIPRDLPPETVL
LYLDSNQITSIPNEIFKDLHQLRVLNLSKNGIEFI
DEHAFKGVAETLQTLDLSDNRIQSVHKNAFNNLKA
RARIANNPWHCDCTLQQVLRSMASNHETAHNVICK
TSVLD
Storage
-20C
Provider Type Product Number
- No reagents -