Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA034735 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA034735, RRID:AB_10696363
- Product name
- Anti-ATP6V1C2
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
REREEMARLLSDKKQQYQTSCVALKKGSSTFPDHK
VKVTPLGNPDRPAAGQTDRERESEGEG- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Mutant Lef1 controls Gata6 in sebaceous gland development and cancer
Wounding induces dedifferentiation of epidermal Gata6+ cells and acquisition of stem cell properties
Oulès B, Rognoni E, Hoste E, Goss G, Fiehler R, Natsuga K, Quist S, Mentink R, Donati G, Watt F
The EMBO Journal 2019;38(9)
The EMBO Journal 2019;38(9)
Wounding induces dedifferentiation of epidermal Gata6+ cells and acquisition of stem cell properties
Donati G, Rognoni E, Hiratsuka T, Liakath-Ali K, Hoste E, Kar G, Kayikci M, Russell R, Kretzschmar K, Mulder K, Teichmann S, Watt F
Nature Cell Biology 2017;19(6):603-613
Nature Cell Biology 2017;19(6):603-613
No comments: Submit comment
No validations: Submit validation data