HPA013753

LSMEM1 antibody from Sigma-Aldrich
C7orf53, FLJ39575
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013753
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013753, RRID:AB_1848926
Product name
Anti-C7orf53 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013753
Antibody type
Polyclonal
Antigen
Coiled-coil domain-containing transmembrane protein C7orf53 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HSSQDTGSCGIQEDGKLYVVDSINDLNKLNLCPAG
SQHLFPLEDKIPVLGTNSGNGSRS
Storage
-20C
Provider Type Product Number
- No reagents -