Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00083440-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00083440-M01, RRID:AB_529951
- Product name
- ADPGK monoclonal antibody (M01), clone 1E4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ADPGK.
- Antigen sequence
SLRAPQEFMTSHSEAGSRIVLNPNKPVVEWHREGI
SFHFTPVLVCKDPIRTVGLGDAISAEGLFYSEVHP
HY- Isotype
- IgG
- Antibody clone number
- 1E4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Expression and role in glycolysis of human ADP-dependent glucokinase.
Richter S, Richter JP, Mehta SY, Gribble AM, Sutherland-Smith AJ, Stowell KM, Print CG, Ronimus RS, Wilson WR
Molecular and cellular biochemistry 2012 May;364(1-2):131-45
Molecular and cellular biochemistry 2012 May;364(1-2):131-45
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of ADPGK expression in transfected 293T cell line by ADPGK monoclonal antibody (M01), clone 1E4.Lane 1: ADPGK transfected lysate(54.1 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ADPGK monoclonal antibody (M01), clone 1E4. Western Blot analysis of ADPGK expression in Raw 264.7(Cat # L024V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged ADPGK is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol