PAB23860
antibody from Abnova Corporation
Targeting: EXOSC9
p5, p6, PM/Scl-75, PMSCL1, RRP45, Rrp45p
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB23860 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#PAB23860, RRID:AB_11122784
- Product name
- EXOSC9 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant EXOSC9.
- Antigen sequence
CVVAGEKVWQIRVDLHLLNHDGNIIDAASIAAIVA
LCHFRRPDVSVQGDEVTLYTPEERDPVPLSIHHMP
ICVSFA- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human cerebellum with EXOSC9 polyclonal antibody (Cat # PAB23860) shows strong cytoplasmic positivity in purkinje cells at 1:20-1:50 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)