HPA014045

PLB1 antibody from Sigma-Aldrich
FLJ30866, PLB
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014045
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014045, RRID:AB_1855317
Product name
Anti-PLB1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014045
Antibody type
Polyclonal
Antigen
Phospholipase B1, membrane-associated precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SSDLPTSWRGLSWSIGGDGNLETHTTLPNILKKFN
PYLLGFSTSTWEGTAGLNVAAEGARARDMPAQAWD
LVERMKNSPDINLEKDWKLVTLFIGVNDLCHYCEN
PEAHLATEYVQHIQQALDILSEELPRAFVNVVE
Storage
-20C
Provider Type Product Number
- No reagents -