ABIN183050

RIN3 antibody from antibodies-online
FLJ22439
Western blot
Data presented on provider website

Antibody data

Product number
ABIN183050
Provider
antibodies-online
Product name
anti-Ras and Rab Interactor 3 (RIN3) antibody
Provider product page
antibodies-online - ABIN183050
Antibody type
Polyclonal
Antigen
The immunogen for anti-RIN3 antibody: synthetic peptide directed towards the N terminal of human RIN3
Reactivity
Human, Mouse
Host
Rabbit
Antigen sequence
AGMFLVRRDSSSKQLVLCVHFPSLNESSAEVLEYT
IKEEK SILYLEGSAL
Vial size
0.1 mg