AV34618

RIN3 antibody from MilliporeSigma / Merck KGaA
FLJ22439
No application information provided.

Antibody data

Product number
AV34618
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-RIN3 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - AV34618
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human RIN3 with an internal ID of P05808
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
EVARILHRVVAGMFLVRRDSSSKQLVLCVHFPSLN
ESSAEVLEYTIKEEK
Storage
-20C