Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001041-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001041-M01, RRID:AB_490110
- Product name
- CDSN monoclonal antibody (M01), clone 6F11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CDSN.
- Antigen sequence
YLVPGMTYSKGKIYPVGYFTKENPVKGSPGVPSFA
AGPPISEGKYFSSNP- Isotype
- IgG
- Antibody clone number
- 6F11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Development and organization of human stratum corneum after birth: electron microscopy isotropy score and immunocytochemical corneocyte labelling as epidermal maturation's markers in infancy.
Fluhr JW, Lachmann N, Baudouin C, Msika P, Darlenski R, De Belilovsky C, Bossert J, Colomb E, Burdin B, Haftek M
The British journal of dermatology 2014 Nov;171(5):978-86
The British journal of dermatology 2014 Nov;171(5):978-86
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged CDSN is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol