Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00023475-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00023475-M01, RRID:AB_490091
- Product name
- QPRT monoclonal antibody (M01), clone 5D11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant QPRT.
- Antigen sequence
VEVECSSLQEAVQAAEAGADLVLLDNFKPEELHPT
ATVLKAQFPSVAVEASGGITLDNLPQFCGPHIDVI
SMGMLTQAAPALDFSLKLFAKEVAPVPKIH- Isotype
- IgG
- Antibody clone number
- 5D11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references QPRT: a potential marker for follicular thyroid carcinoma including minimal invasive variant; a gene expression, RNA and immunohistochemical study.
Hinsch N, Frank M, Döring C, Vorländer C, Hansmann ML
BMC cancer 2009 Mar 26;9:93
BMC cancer 2009 Mar 26;9:93
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- QPRT monoclonal antibody (M01), clone 5D11 Western Blot analysis of QPRT expression in HepG2 ( Cat # L019V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged QPRT is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to QPRT on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
