Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [6]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA030782 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA030782, RRID:AB_10600930
- Product name
- Anti-MKL1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
EQEKRAQQPAPAPAPLGTPVKQENSFSSCQLSQQP
LGPAHPFNPSLAAPATNHIDPCAVAPGPPSVVVKQ
EALQPEPEPVPAPQLLLGPQGPSLIKGVAPPTLIT
DSTGTHLVLTVTNKNADSPG- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Immunodeficiency and severe susceptibility to bacterial infection associated with a loss-of-function homozygous mutation of MKL1
Dynamic tensile forces drive collective cell migration through three-dimensional extracellular matrices.
Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells
The transcriptional coactivators megakaryoblastic leukemia 1/2 mediate the effects of loss of the tumor suppressor deleted in liver cancer 1
Record J, Malinova D, Zenner H, Plagnol V, Nowak K, Syed F, Bouma G, Curtis J, Gilmour K, Cale C, Hackett S, Charras G, Moulding D, Nejentsev S, Thrasher A, Burns S
Blood 2015 September;126(13):1527-1535
Blood 2015 September;126(13):1527-1535
Dynamic tensile forces drive collective cell migration through three-dimensional extracellular matrices.
Gjorevski N, Piotrowski AS, Varner VD, Nelson CM
Scientific reports 2015 Jul 13;5:11458
Scientific reports 2015 Jul 13;5:11458
Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells
Stadler C, Rexhepaj E, Singan V, Murphy R, Pepperkok R, Uhlén M, Simpson J, Lundberg E
Nature Methods 2013 February;10(4):315-323
Nature Methods 2013 February;10(4):315-323
The transcriptional coactivators megakaryoblastic leukemia 1/2 mediate the effects of loss of the tumor suppressor deleted in liver cancer 1
Muehlich S, Hampl V, Khalid S, Singer S, Frank N, Breuhahn K, Gudermann T, Prywes R
Oncogene 2011 December;31(35):3913-3923
Oncogene 2011 December;31(35):3913-3923
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Western blot analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-MKL1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
- Sample type
- HUMAN
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human testis and liver tissues using HPA030782 antibody. Corresponding MKL1 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lymph node shows cytoplasmic positivity in lymphocytes.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows positivity in cells in seminiferous ducts.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lymph node shows moderate positivity in lymphoid cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lung shows moderate cytoplasmic positivity in macrophages.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows very weak positivity in hepatocytes.
- Sample type
- HUMAN