H00084162-B01

KIAA1109 antibody from Abnova Corporation
FLJ21404, FSA, KIAA1371, Tweek

Antibody data

Product number
H00084162-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00084162-B01, RRID:AB_1204569
Product name
KIAA1109 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00084162-B01
Antibody type
Polyclonal
Antigen
KIAA1109 (AAH45783, 1 a.a. ~ 191 a.a) full-length human protein.
Reactivity
Human
Host
Mouse
Antigen sequence
MQLDFKSIHVQEPQEPSLQDASLKPKVECSVVTEF
TDHICVTMDAELIMFLHDLVSAYLKEKEKAIFPPR
ILSTRPGQKSPIIIHDDNSSDKDREDSITYTTVDW
RDFMCNTWHLEPTLRLISWTGRKIDPVGVDYILQK
LGFHHARTTIPKWLQRGVMDPLDKVLSVLIKKLGT
ALQDEKEKKGKDKEEH
Vial size
50 uL
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -