Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00345193-M09 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00345193-M09, RRID:AB_606253
- Product name
- LRIT3 monoclonal antibody (M09), clone 3E7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant LRIT3.
- Antigen sequence
KVCKLQCKSEPFWEDDLAKETYIQFETLFPRSQSV
GELWTRSHRDDSEKLLLCSRSSVESQVTFKSEGSR
PEYYC- Isotype
- IgG
- Antibody clone number
- 3E7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of LRIT3 expression in transfected 293T cell line by LRIT3 monoclonal antibody (M09), clone 3E7.Lane 1: LRIT3 transfected lysate(60.521 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged LRIT3 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to LRIT3 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 1.2 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol