HPA000604

C22orf31 antibody from Sigma-Aldrich
bK747E2.1, HS747E2A
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000604
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000604, RRID:AB_1079086
Product name
Anti-C22orf31 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000604
Antibody type
Polyclonal
Antigen
Uncharacterized protein C22orf31 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LTVRQDLEDRYAEHVAATQALPQDSGTAAWKGRVL
LPETQKRQQLSEDTLTIHGLPTEGYQALYHAVVEP
MLWNPSGTPKRYSLELGKAIKQKLWEALCSQGAIS
EGAQRDRFPGRKQPGVHEEPVLKKWPKLKSK
Storage
-20C
Provider Type Product Number
- No reagents -