H00010478-M04

SLC25A17 antibody from Abnova Corporation
PMP34
No application information provided.

Antibody data

Product number
H00010478-M04
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010478-M04, RRID:AB_1237867
Product name
SLC25A17 monoclonal antibody (M04), clone 3B10
Provider product page
Abnova Corporation - H00010478-M04
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant SLC25A17.
Antigen sequence
MASVLSYESLVHAVAGAVGSVTAMTVFFPLDTARL
RLQVDEKRKSKTTHMVLLEIIKEEGLLAPYRGWFP
VISSLCCSNFVYFYTFNSLKALWVKGQHSTTGKDL
VVGFVAGVVNVLLTTPLWVVNTRLKLQGAKFRNED
IVPTNYKGIIDAFHQIIRDEGISALWNGTFPSLLL
VFNPAIQFMFYEGLKRQLLKKRMKLSSLDVFIIGA
VAKAIATTVTYPLQTVQSILRFGRHRLNPENRTLG
SLRNILYLLHQRVRRFGIMGLYKGLEAKLLQTVLT
AALMFLVYEKLTAATFTVMGLKRAHQH
Isotype
IgG
Antibody clone number
3B10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -