Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA013407 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA013407, RRID:AB_1848386
- Product name
- Anti-FAM19A1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
VKCSCLPGKVAGTTRNRPSCVDASIVIGKWWCEME
PCLEGEECKTLPDNSGWMCATGNKIKTTR- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references In vivo survival and differentiation of Friedreich ataxia iPSC-derived sensory neurons transplanted in the adult dorsal root ganglia.
Unbiased classification of sensory neuron types by large-scale single-cell RNA sequencing
Viventi S, Frausin S, Howden SE, Lim SY, Finol-Urdaneta RK, McArthur JR, Abu-Bonsrah KD, Ng W, Ivanusic J, Thompson L, Dottori M
Stem cells translational medicine 2021 Aug;10(8):1157-1169
Stem cells translational medicine 2021 Aug;10(8):1157-1169
Unbiased classification of sensory neuron types by large-scale single-cell RNA sequencing
Usoskin D, Furlan A, Islam S, Abdo H, Lönnerberg P, Lou D, Hjerling-Leffler J, Haeggström J, Kharchenko O, Kharchenko P, Linnarsson S, Ernfors P
Nature Neuroscience 2014;18(1):145-153
Nature Neuroscience 2014;18(1):145-153
No comments: Submit comment
No validations: Submit validation data