H00010916-M04
antibody from Abnova Corporation
Targeting: MAGED2
11B6, BCG1, HCA10, JCL-1, MAGE-D2, MAGED, MGC8386
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010916-M04 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010916-M04, RRID:AB_534965
- Product name
- MAGED2 monoclonal antibody (M04), clone 6G10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant MAGED2.
- Antigen sequence
AEASEKDSSSMMQTLLTVTQNVEVPETPKASKALE
VSEDVKVSKASGVSKATEVSKTPEAREAPATQASS
TTQLTDTQVLAAENKSLAADTKKQNADPQAVTMPA
TETKK- Isotype
- IgG
- Antibody clone number
- 6G10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged MAGED2 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to MAGED2 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol