H00054097-M07

FAM3B antibody from Abnova Corporation
2-21, C21orf11, C21orf76, D21M16SJHU19e, ORF9, PANDER, PRED44

Antibody data

Product number
H00054097-M07
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00054097-M07, RRID:AB_1574798
Product name
FAM3B monoclonal antibody (M07), clone 1E7
Provider product page
Abnova Corporation - H00054097-M07
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant FAM3B.
Antigen sequence
MRPLAGGLLKVVFVVFASLCAWYSGYLLAELIPDA
PLSSAAYSIRSIGERPVLKAPVPKRQKCDHWTPCP
SDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNV
ARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTK
FIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALG
SKEIRNMKFRSSWVFIAAKGLELPSEIQREKINHS
DAKNNRYSGWPAEIQIEGCIPKERS
Isotype
IgG
Antibody clone number
1E7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -