H00054097-M07
antibody from Abnova Corporation
Targeting: FAM3B
2-21, C21orf11, C21orf76, D21M16SJHU19e, ORF9, PANDER, PRED44
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunoprecipitation [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00054097-M07 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00054097-M07, RRID:AB_1574798
- Product name
- FAM3B monoclonal antibody (M07), clone 1E7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full-length recombinant FAM3B.
- Antigen sequence
MRPLAGGLLKVVFVVFASLCAWYSGYLLAELIPDA
PLSSAAYSIRSIGERPVLKAPVPKRQKCDHWTPCP
SDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNV
ARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTK
FIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALG
SKEIRNMKFRSSWVFIAAKGLELPSEIQREKINHS
DAKNNRYSGWPAEIQIEGCIPKERS- Isotype
- IgG
- Antibody clone number
- 1E7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- FAM3B monoclonal antibody (M07), clone 1E7. Western Blot analysis of FAM3B expression in human kidney.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of FAM3B expression in transfected 293T cell line by FAM3B monoclonal antibody (M07), clone 1E7.Lane 1: FAM3B transfected lysate(26 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged FAM3B is 1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of FAM3B transfected lysate using anti-FAM3B monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with FAM3B MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to FAM3B on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol