HPA015885

FAM3B antibody from Sigma-Aldrich
2-21, C21orf11, C21orf76, D21M16SJHU19e, ORF9, PANDER, PRED44
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015885
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015885, RRID:AB_1848396
Product name
Anti-FAM3B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015885
Antibody type
Polyclonal
Antigen
Protein FAM3B precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQ
LGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSG
PMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAI
EALGSKEIRN
Storage
-20C
Provider Type Product Number
- No reagents -