HPA015885

FAM3B antibody from Atlas Antibodies
2-21, C21orf11, C21orf76, D21M16SJHU19e, ORF9, PANDER, PRED44
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA015885
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA015885, RRID:AB_1848396
Product name
Anti-FAM3B
Provider product page
Atlas Antibodies - HPA015885
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQ
LGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSG
PMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAI
EALGSKEIRN
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -