Antibody data

Product number
PAB20692
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20692, RRID:AB_10983998
Product name
LRRC55 polyclonal antibody
Provider product page
Abnova Corporation - PAB20692
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant LRRC55.
Antigen sequence
RLAHLDLSYNNFSHVPADMFQEAHGLVHIDLSHNP
WLRRVHPQAFQGLMQLRDLDLSYGGLAFLSLEALE
GLPGLVTLQIGGNPWVCGCTMEPLLKWLRNRIQRC
TADSQ
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.