HPA014053

LRRC55 antibody from Sigma-Aldrich
FLJ45686
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014053
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014053, RRID:AB_2137630
Product name
Anti-LRRC55 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014053
Antibody type
Polyclonal
Antigen
Leucine-rich repeat-containing protein 55 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RLAHLDLSYNNFSHVPADMFQEAHGLVHIDLSHNP
WLRRVHPQAFQGLMQLRDLDLSYGGLAFLSLEALE
GLPGLVTLQIGGNPWVCGCTMEPLLKWLRNRIQRC
TADSQ
Storage
-20C
Provider Type Product Number
- No reagents -