HPA014053

LRRC55 antibody from Atlas Antibodies
FLJ45686
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA014053
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA014053, RRID:AB_2137630
Product name
Anti-LRRC55
Provider product page
Atlas Antibodies - HPA014053
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RLAHLDLSYNNFSHVPADMFQEAHGLVHIDLSHNP
WLRRVHPQAFQGLMQLRDLDLSYGGLAFLSLEALE
GLPGLVTLQIGGNPWVCGCTMEPLLKWLRNRIQRC
TADSQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -