HPA024616

GREB1 antibody from Sigma-Aldrich
KIAA0575
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024616
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024616, RRID:AB_10599728
Product name
Anti-GREB1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024616
Antibody type
Polyclonal
Antigen
growth regulation by estrogen in breast cancer 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EGDIDILLDKFHQENQGHISSSLAASSVTKAASLD
VSGTPVCTSYNLEPHSIRPFQLAVAQKLLSHVCSI
ADSSTQNLDLGSFEKVDFLICIP
Storage
-20C
Provider Type Product Number
- No reagents -