H00028998-B01

MRPL13 antibody from Abnova Corporation
L13, L13A, L13mt, RPL13, RPML13

Antibody data

Product number
H00028998-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00028998-B01, RRID:AB_1114387
Product name
MRPL13 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00028998-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human MRPL13 protein.
Antigen sequence
MSSFSRAPQQWATFARIWYLLDGKMQPPGKLAAMA
SIRLQGLHKPVYHALSDCGDHVVIMNTRHIAFSGN
KWEQKVYSSHTGYPGGFRQVTAAQLHLRDPVAIVK
LAIYGMLPKNLHRRTMMERLHLFPDEYIPEDILKN
LVEELPQPRKIPKRLDEYTQEEIDAFPRLWTPPED
YRL
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -