Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN311203 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Immunoglobulin Superfamily Containing Leucine-Rich Repeat 2 (ISLR2) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ISLR2 antibody: synthetic peptide directed towards the N terminal of human ISLR2
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Antigen sequence
PFHCGCGLVWLQAWAASTRVSLPEPDSIACASPPA
LQGVP VYRLPALPCA- Vial size
- 50 µg
Submitted references The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
Fugu ESTs: new resources for transcription analysis and genome annotation.
Clark HF, Gurney AL, Abaya E, Baker K, Baldwin D, Brush J, Chen J, Chow B, Chui C, Crowley C, Currell B, Deuel B, Dowd P, Eaton D, Foster J, Grimaldi C, Gu Q, Hass PE, Heldens S, Huang A, Kim HS, Klimowski L, Jin Y, Johnson S, Lee J, Lewis L, Liao D, Mark M, Robbie E, Sanchez C, Schoenfeld J, Seshagiri S, Simmons L, Singh J, Smith V, Stinson J, Vagts A, Vandlen R, Watanabe C, Wieand D, Woods K, Xie MH, Yansura D, Yi S, Yu G, Yuan J, Zhang M, Zhang Z, Goddard A, Wood WI, Godowski P, Gray A
Genome research 2003 Oct;13(10):2265-70
Genome research 2003 Oct;13(10):2265-70
Fugu ESTs: new resources for transcription analysis and genome annotation.
Clark MS, Edwards YJ, Peterson D, Clifton SW, Thompson AJ, Sasaki M, Suzuki Y, Kikuchi K, Watabe S, Kawakami K, Sugano S, Elgar G, Johnson SL
Genome research 2003 Dec;13(12):2747-53
Genome research 2003 Dec;13(12):2747-53
No comments: Submit comment
No validations: Submit validation data