H00010423-M02A

CDIPT antibody from Abnova Corporation
PIS, PIS1
No application information provided.

Antibody data

Product number
H00010423-M02A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010423-M02A, RRID:AB_1204127
Product name
CDIPT monoclonal antibody (M02A), clone 1F8
Provider product page
Abnova Corporation - H00010423-M02A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant CDIPT.
Antigen sequence
MPDENIFLFVPNLIGYARIVFAIISFYFMPCCPLT
ASSFYLLSGLLDAFDGHAARALNQGTRFGAMLDML
TDRCSTMCLLVNLALLYPGATLFFQISMSLDVASH
WLHLHSSVVRGSESHKMIDLSGNPVLRIYYTSRPA
LFTLCAGNELFYCLLYLFHFSEGPLVGSVGLFRMG
LWVTAPIALLKSLISVIHLITAARNMAALDAADRA
KKK
Isotype
IgM
Antibody clone number
1F8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -