HPA015581

PCDH9 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015581
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015581, RRID:AB_1855048
Product name
Anti-PCDH9 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015581
Antibody type
Polyclonal
Antigen
Protocadherin-9 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QELIYTIREELPENVPIGNIPKDLNISHINAATGT
SASLVYRLVSKAGDAPLVKVSSSTGEIFTTSNRID
REKLCAGASYAEENECFFELEVVILPNDFFRLIKI
KIIVKDTNDNAPMFPSPVIN
Storage
-20C
Provider Type Product Number
- No reagents -