HPA035593

RASGEF1A antibody from Atlas Antibodies
CG4853, FLJ37817

Antibody data

Product number
HPA035593
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA035593, RRID:AB_10602083
Product name
Anti-RASGEF1A
Provider product page
Atlas Antibodies - HPA035593
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
HIELDRVSSIYPEDLMQIVSHMDSLDNHRCRGDLT
KTYSLEAYDNWFNCLSMLVATEVCRVVKKKHRTRM
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.