SAB2101948

RASGEF1A antibody from MilliporeSigma / Merck KGaA
CG4853, FLJ37817
No application information provided.

Antibody data

Product number
SAB2101948
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-RASGEF1A antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - SAB2101948
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_660356.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TFLLSSRVFMPPHDLLARVGQICVEQKQQLEAGPE
KAKLKSFSAKIVQLL
Storage
-20C