HPA014541

LRRC19 antibody from Sigma-Aldrich
FLJ21302
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014541
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014541, RRID:AB_1853301
Product name
Anti-LRRC19 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014541
Antibody type
Polyclonal
Antigen
Leucine-rich repeat-containing protein 19 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NLWNCSCSLFNLQNWLNTSNVTLENENITMCSYPN
SLQSYNIKTVPHKAECHSKFPSSVTEDLYIHFQPI
SNSI
Storage
-20C
Provider Type Product Number
- No reagents -