HPA013656

NCMAP antibody from Sigma-Aldrich
C1orf130, FLJ42528, MP11
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013656
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013656, RRID:AB_2275006
Product name
Anti-C1orf130 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013656
Antibody type
Polyclonal
Antigen
Uncharacterized protein C1orf130 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YNRKMRTRRELEPKGPKPTAPSAVGPNSNGSQHPA
TVTFSPVDVQVE
Storage
-20C
Provider Type Product Number
- No reagents -