Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502087 - Provider product page 
- Provider
- antibodies-online
- Product name
- anti-WD Repeat Domain 8 (WDR8) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-WDR8 antibody: synthetic peptide directed towards the middle region of human WDR8
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
- GCLSFPPPRAGAGPLPSSESKYEIASVPVSLQTLK
 PVTDR ANPKMGIGML
- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references		Large-scale mapping of human protein-protein interactions by mass spectrometry.
				
		
	
			Ewing RM, Chu P, Elisma F, Li H, Taylor P, Climie S, McBroom-Cerajewski L, Robinson MD, O'Connor L, Li M, Taylor R, Dharsee M, Ho Y, Heilbut A, Moore L, Zhang S, Ornatsky O, Bukhman YV, Ethier M, Sheng Y, Vasilescu J, Abu-Farha M, Lambert JP, Duewel HS, Stewart II, Kuehl B, Hogue K, Colwill K, Gladwish K, Muskat B, Kinach R, Adams SL, Moran MF, Morin GB, Topaloglou T, Figeys D
Molecular systems biology 2007;3:89
		Molecular systems biology 2007;3:89
				No comments: Submit comment	
	
			
							
					Supportive validation
					
									
				
		- Submitted by
- antibodies-online (provider)
- Main image
 
- Experimental details
- Image(s): Western Blotting