HPA035287

DPH3 antibody from MilliporeSigma / Merck KGaA
DELGIP, DELGIP1, DESR1, DPH3A, KTI11, MGC20197, ZCSL2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA035287
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA035287, RRID:AB_10604113
Product name
Anti-DPH3 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA035287
Antibody type
Polyclonal
Antigen
DPH3, KTI11 homolog (S. cerevisiae) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EDFQYDEDSETYFYPCPCGDNFSITKEDLENGEDV
ATCPSCSLIIKVIYDKDQFVCGETVPAPSANKELV
K
Storage
-20C
Provider Type Product Number
- No reagents -