Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [2]
- Immunocytochemistry [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003956-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003956-M01, RRID:AB_425528
- Product name
- LGALS1 monoclonal antibody (M01), clone 1E8-1B2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant LGALS1.
- Antigen sequence
MACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNL
GKDSNNLCLHFNPRFNAHGDANTIVCNSKDGGAWG
TEQREAVFPFQPGSVAEVCITFDQANLTVKLPDGY
EFKFPNRLNLEAINYMAADGDFKIKCVAFD- Isotype
- IgG
- Antibody clone number
- 1E8-1B2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Galectin-1 and Galectin-3 Mediate Protocadherin-24-Dependent Membrane Localization of β-catenin in Colon Cancer Cell Line HCT116.
Quantitative and temporal proteome analysis of butyrate-treated colorectal cancer cells.
Ose R, Oharaa O, Nagase T
Current chemical genomics 2012;6:18-26
Current chemical genomics 2012;6:18-26
Quantitative and temporal proteome analysis of butyrate-treated colorectal cancer cells.
Tan HT, Tan S, Lin Q, Lim TK, Hew CL, Chung MC
Molecular & cellular proteomics : MCP 2008 Jun;7(6):1174-85
Molecular & cellular proteomics : MCP 2008 Jun;7(6):1174-85
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- LGALS1 monoclonal antibody (M01), clone 1E8-1B2 Western Blot analysis of LGALS1 expression in HepG2 ( Cat # L019V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of LGALS1 expression in transfected 293T cell line by LGALS1 monoclonal antibody (M01), clone 1E8-1B2.Lane 1: LGALS1 transfected lysate(14.7 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged LGALS1 is 1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged LGALS1 is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to LGALS1 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of LGALS1 transfected lysate using anti-LGALS1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with LGALS1 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol