Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [4]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003956-D01P - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003956-D01P, RRID:AB_1575730
- Product name
- LGALS1 purified MaxPab rabbit polyclonal antibody (D01P)
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against a full-length human LGALS1 protein.
- Antigen sequence
MACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNL
GKDSNNLCLHFNPRFNAHGDANTIVCNSKDGGAWG
TEQREAVFPFQPGSVAEVCITFDQANLTVKLPDGY
EFKFPNRLNLEAINYMAADGDFKIKCVAFD- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Transgenic overexpression of the α7 integrin reduces muscle pathology and improves viability in the dy(W) mouse model of merosin-deficient congenital muscular dystrophy type 1A.
Doe JA, Wuebbles RD, Allred ET, Rooney JE, Elorza M, Burkin DJ
Journal of cell science 2011 Jul 1;124(Pt 13):2287-97
Journal of cell science 2011 Jul 1;124(Pt 13):2287-97
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of LGALS1 expression in transfected 293T cell line (H00003956-T01) by LGALS1 MaxPab polyclonal antibody.Lane 1: LGALS1 transfected lysate(14.70 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- LGALS1 MaxPab rabbit polyclonal antibody. Western Blot analysis of LGALS1 expression in human kidney.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- LGALS1 MaxPab rabbit polyclonal antibody. Western Blot analysis of LGALS1 expression in mouse spleen.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- LGALS1 MaxPab rabbit polyclonal antibody. Western Blot analysis of LGALS1 expression in HeLa.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of purified MaxPab antibody to LGALS1 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol